.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t3h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray Structure of Dephospho-CoA Kinase from E. coli Norteast Structural Genomics Consortium Target ER57. TO BE PUBLISHED
    Site NESGC
    PDB Id 1t3h Target Id ER57
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8860,PF01121, 3.40.50.300 Molecular Weight 22620.48 Da.
    Residues 206 Isoelectric Point 5.77
    Sequence mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmiaadgtlqrra lrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvenslykkanrvlvvdvspetql krtmqrddvtrehveqilaaqatrearlavaddvidnngapdaiasdvarlhahylqlasqfvsqekp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.284
    Matthews' coefficent 2.50 Rfactor 0.238
    Waters 143 Solvent Content 50.00

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1t3h
    1. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch