.
The Open Protein Structure Annotation Network
PDB Keyword
.

1spv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Phosphatase of Escherichia coli, Northeast Structural Genomoics Target ER58. To be Published
    Site NESGC
    PDB Id 1spv Target Id ER58
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8861,PF01661, 3.40.220.10 Molecular Weight 18879.37 Da.
    Residues 177 Isoelectric Point 5.44
    Sequence mktrihvvqgditklavdvivnaanpslmggggvdgaihraagpalldaclkvrqqqgdcptghavitl agdlpakavvhtvgpvwrggeqnedqllqdaylnslrlvaansytsvafpaistgvygypraaaaeiav ktvsefitrhalpeqvyfvcydeenahlyerlltqqgde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.232
    Matthews' coefficent 2.26 Rfactor 0.201
    Waters 98 Solvent Content 45.13

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 1spv
    1. Structural and functional basis for ADP-ribose and poly (ADP-ribose) binding by viral macro domains
    MP Egloff, H Malet, Putics, M Heinonen - Journal of , 2006 - Am Soc Microbiol
     
    2. Structural basis of severe acute respiratory syndrome coronavirus ADP-ribose-1 _-phosphate dephosphorylation by a conserved domain of nsP3
    KS Saikatendu, JS Joseph, V Subramanian, T Clayton - Structure, 2005 - Elsevier
     
    3. The high-throughput protein sample production platform of the Northeast Structural Genomics Consortium
    R Xiao, S Anderson, J Aramini, R Belote - Journal of structural , 2010 - Elsevier
     
    4. Crystal structures of the X_domains of a Group_1 and a Group_3 coronavirus reveal that ADP_ribose_binding may not be a conserved property
    Y Piotrowski, G Hansen - Protein , 2009 - Wiley Online Library
     
    5. Crystal structures of two coronavirus ADP-ribose-1 _-monophosphatases and their complexes with ADP-ribose: a systematic structural analysis of the viral ADRP
    Y Xu, L Cong, C Chen, L Wei, Q Zhao, X Xu - Journal of , 2009 - Am Soc Microbiol
     
    6. The structure and catalytic mechanism of a poly (ADP-ribose) glycohydrolase
    D Slade, MS Dunstan, E Barkauskaite, R Weston - Nature, 2011 - nature.com
     
    7. Identification of Macrodomain Proteins as Novel O-Acetyl-ADP-ribose Deacetylases
    D Chen, M Vollmar, MN Rossi, C Phillips - Journal of Biological , 2011 - ASBMB
     
    8. PARG: A Macrodomain in Disguise
    M Hassler, G Jankevicius, AG Ladurner - Structure, 2011 - Elsevier
     
    9. Structure of the X (ADRP) domain of nsp3 from feline coronavirus
    JA Wojdyla, I Manolaridis, EJ Snijder - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch