.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sdj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and function of the phenazine biosynthetic protein PhzF from Pseudomonas fluorescens. Proc.Natl.Acad.Sci.Usa 101 16431-16436 2004
    Site NESGC
    PDB Id 1sdj Target Id ET25
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8869,PF02567, 3.10.310.10 Molecular Weight 32317.09 Da.
    Residues 297 Isoelectric Point 5.84
    Sequence mkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvriryftptvev picghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleqgtpgfepplegetraaii nalhlteddilpglpiqvattghskvmiplkpevdidalspdlnaltaiskkigcngffpfqirpgkne tdgrmfspaigivedpvtgnangpmgawlvhhnvlphdgnvlrvkghqgralgrdgmievtvtirdnqp ekvtisgtavilfhaewaiel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.26
    Matthews' coefficent 2.91 Rfactor 0.218
    Waters 144 Solvent Content 57.73

    Ligand Information
    Ligands SO4 (SULFATE) x 5
    Metals

    Jmol

     
    Google Scholar output for 1sdj
    1. Crystal structure, catalytic mechanism, and mitogenic properties of Trypanosoma cruzi proline racemase
    A Buschiazzo, M Goytia, F Schaeffer - Proceedings of the , 2006 - National Acad Sciences
     
    2. The purification, crystallization and preliminary structural characterization of human MAWDBP, a member of the phenazine biosynthesis-like protein family
    P Herde, W Blankenfeldt - Acta Crystallographica Section F: , 2006 - scripts.iucr.org
     
    3. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch