The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the putative n-type ATP pyrophosphatase from Pyrococcus furiosus, the Northeast Structural Genomics Target PfR23. To be Published
    Site NESGC
    PDB Id 1ru8 Target Id PfR23
    Related PDB Ids 3h7e 
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9017,3.90.1490.10,, PF01902 Molecular Weight 25719.48 Da.
    Residues 229 Isoelectric Point 6.04
    Sequence mvgladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaralgiplvkg ftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytpawgrdakeymrellnl gfkimvvgvsaygldeswlgrildesaleelitlnekykvhvageggefetfvldmplfkykivvdkak kvwepctssgkliieeahlesk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.277
    Matthews' coefficent 2.55 Rfactor 0.218
    Waters 203 Solvent Content 51.72

    Ligand Information


    Google Scholar output for 1ru8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch