.
The Open Protein Structure Annotation Network
PDB Keyword
.

1qyi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF Q8NW41 NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET ZR25. To be Published
    Site NESGC
    PDB Id 1qyi Target Id ZR25
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS9273,3.40.50.1000 Molecular Weight 42656.32 Da.
    Residues 376 Isoelectric Point 4.71
    Sequence mkkilfdvdgvflseercfdvsaltvyellmdkcylglhshidwetltdndiqdirnrifqkdkilnkl kslglnsnwdmlfivfsihlidilkklshdeieafmyqdepvelklqnistnladcfnlneqlplqfld nvkvgknniyaaleefattelhvsdatlfslkgalwtlaqevyqewylgsklyedvekkiarttfktgy iyqeiilrpvdevkvllndlkgagfelgiatgrpytetvvpfenlgllpyfeadfiatasdvleaenmy pqarplgkpnpfsyiaalygnnrdkyesyinkqdnivnkddvfivgdsladllsaqkigatfigtltgl kgkdaageleahhadyvinhlgelrgvldnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.278
    Matthews' coefficent 2.51 Rfactor 0.216
    Waters 186 Solvent Content 50.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1qyi
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. A fourier fingerprint-based method for protein surface representation
    MJ Bayley, EJ Gardiner, P Willett - Journal of chemical , 2005 - ACS Publications
     
    3. Crystal structure of MtnX phosphatase from Bacillus subtilis at 2.0 resolution provides a structural basis for bipartite phosphomonoester hydrolysis of 2_hydroxy_3_
    Q Xu, KS Saikatendu, S Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    4. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch