.
The Open Protein Structure Annotation Network
PDB Keyword
.

1m94

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the Yeast Ubiquitin-Like Modifier Protein Hub1. J.STRUCT.FUNCT.GENOM. 4 25-30 2003
    Site NESGC
    PDB Id 1m94 Target Id YTYst190
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS9265,PF00240, 5481, 3.10.20.90 Molecular Weight 8271.18 Da.
    Residues 73 Isoelectric Point 6.05
    Sequence mievvvndrlgkkvrvkclaedsvgdfkkvlslqigtqpnkivlqkggsvlkdhisledyevhdqtnle lyyl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1m94
    1. A basis for SUMO protease specificity provided by analysis of human Senp2 and a Senp2-SUMO complex
    D Reverter, CD Lima - Structure, 2004 - Elsevier
     
    2. Mechanical stretching of proteinsa theoretical survey of the Protein Data Bank
    JI Su_kowska, M Cieplak - Journal of Physics: Condensed Matter, 2007 - iopscience.iop.org
     
    3. The ubiquitin domain superfold: structure-based sequence alignments and characterization of binding epitopes
    C Kiel, L Serrano - Journal of molecular biology, 2006 - Elsevier
     
    4. Post-translational regulation in plants employing a diverse set of polypeptide tags
    B Downes, RD Vierstra - Biochemical Society Transactions, 2005 - www-06.all-portland.net
     
    5. Histone H2B ubiquitylation disrupts local and higher-order chromatin compaction
    B Fierz, C Chatterjee, RK McGinty - Nature chemical , 2011 - nature.com
     
    6. Structure of a complex between Nedd8 and the Ulp/Senp protease family member Den1
    D Reverter, K Wu, TG Erdene, ZQ Pan - Journal of molecular , 2005 - Elsevier
     
    7. A correspondence between solution-state dynamics of an individual protein and the sequence and conformational diversity of its family
    GD Friedland, NA Lakomek, C Griesinger - PLoS computational , 2009 - dx.plos.org
     
    8. Structural analysis of UBL5, a novel ubiquitin_like modifier
    T McNally, Q Huang, RS Janis, Z Liu - Protein , 2003 - Wiley Online Library
     
    9. Refinement of NMR_determined protein structures with database derived mean_force potentials
    D Wu, R Jernigan, Z Wu - Proteins: Structure, Function, and , 2007 - Wiley Online Library
     
    10. Identification and structural characterization of a CBP/p300-binding domain from the ETS family transcription factor GABP_
    HS Kang, ML Nelson, CD Mackereth, M Schrpf - Journal of molecular , 2008 - Elsevier
     
    11. Structural and electrostatic properties of ubiquitination and related pathways
    PJ Winn, M Zahran, JN Battey, Y Zhou, RC Wade - Front Biosci, 2007 - bioscience.org
     
    12. Crystal structure of the ubiquitin-like protein YukD from Bacillus subtilis
    F van den Ent, J Lwe - FEBS letters, 2005 - Elsevier
     
    13. Ubiquitin and Ubiquitin-like Modifiers in Plants
    HJ Park, HC Park, SY Lee, HJ Bohnert, DJ Yun - Journal of Plant Biology, 2011 - Springer
     
    14. Superimposition of protein structures with dynamically weighted RMSD
    D Wu, Z Wu - Journal of Molecular Modeling, 2010 - Springer
     
    15. Distance-based protein structure modeling
    D Wu - 2006 - books.google.com
     
    16. . REFINEMENT OF NMR-DETERMINED PROTEIN STRUCTURES WITH DATABASE DERIVED POTENTIALS
    D Wu, R Jernigan, Z Wu - Distance-based protein structure , 2006 - math.iastate.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch