.
The Open Protein Structure Annotation Network
PDB Keyword
.

1eo1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure Determination and Structure-Based Functional Characterization of Conserved Hypothetical Protein MTH1175 from Methanobacterium Thermoautotrophicum. J.STRUCT.FUNCT.GENOM. 1 15-25 2000
    Site NESGC
    PDB Id 1eo1 Target Id TP2
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9186,3.30.420.130, 4796, PF02579 Molecular Weight 13159.16 Da.
    Residues 124 Isoelectric Point 9.51
    Sequence mkiaiassgtdlgsevsrffgrapyfmivemkkgniessevienpsasasggagirtaqiianngvkav iasspgpnafevlnelgikiyratgtsveenlklftegnleeirspgsgrgrrrr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1eo1
    1. Structural proteomics of an archaeon
    D Christendat, A Yee, A Dharamsi, Y Kluger - nature structural , 2000 - pdg.cnb.uam.es
     
    2. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    3. Using property based sequence motifs and 3D modeling to determine structure and functional regions of proteins
    I Ovidiu, O Numan, VS Mathura - Current medicinal , 2004 - ingentaconnect.com
     
    4. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    5. Refining homology models by combining replica_exchange molecular dynamics and statistical potentials
    J Zhu, H Fan, X Periole, B Honig - : Structure, Function, and , 2008 - Wiley Online Library
     
    6. Inhibition of Bacteriophage _ protein phosphatase by organic and oxoanion inhibitors
    NJ Reiter, DJ White, F Rusnak - Biochemistry, 2002 - ACS Publications
     
    7. NMR structure determination and structure-based functional characterization of conserved hypothetical protein MTH1175 from Methanobacterium
    JR Cort, A Yee, AM Edwards, CH Arrowsmith - Journal of structural and , 2000 - Springer
     
    8. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    9. NMR structure of the protein NP_247299. 1: comparison with the crystal structure
    K Jaudzems, M Geralt, P Serrano - Section F: Structural , 2010 - scripts.iucr.org
     
    10. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    11. Evaluating the solution from MrBUMP and BALBES
    RM Keegan, F Long, VJ Fazio, MD Winn - Section D: Biological , 2011 - scripts.iucr.org
     
    12. Superimposition of protein structures with dynamically weighted RMSD
    D Wu, Z Wu - Journal of Molecular Modeling, 2010 - Springer
     
    13. Protein Structure Prediction Using an Augmented Homology Modeling Method: Key Importance of Iterative-Procedures for Obtaining Consistent Quality Models
    S McDonald, S Mylvaganam - Current , 2005 - ingentaconnect.com
     
    14. The Anaerobe-Specific Orange Protein Complex of Desulfovibrio vulgaris Hildenborough Is Encoded by Two Divergent Operons Coregulated by _54 and a Cognate
    A Fivet, E Cascales, M Ansaldi, SR Pauleta - Journal of , 2011 - Am Soc Microbiol
     
    15. Crystallization and crystallographic analysis of the apo form of the orange protein (ORP) from Desulfovibrio gigas
    S Najmudin, C Bonifacio, AG Duarte - Section F: Structural , 2009 - scripts.iucr.org
     
    16. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    17. Resolution-by-proxy: a simple measure for assessing and comparing the overall quality of NMR protein structures
    M Berjanskii, J Zhou, Y Liang, G Lin - Journal of biomolecular , 2012 - Springer
     
    18. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    19. A new computationally facile analytical approximation of electrostatic potential suitable for macromolecules.
    JC Gordon - 2007 - scholar.lib.vt.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch