.
The Open Protein Structure Annotation Network
PDB Keyword
.

1eje

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural proteomics of an archaeon. Nat.Struct.Biol. 7 903-909 2000
    Site NESGC
    PDB Id 1eje Target Id TT1
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9192,2.30.110.10, PF01613 Molecular Weight 20873.57 Da.
    Residues 192 Isoelectric Point 5.21
    Sequence gsqaahmmsmdfedfpvesahriltprptvmvttvdeegninaapfsftmpvsidppvvafasapdhht arniesthefvinitpadiiermwvtardipageneleaaglawtssrrvkppriveapghlecellrm fevgdhnlitgsvvsasvrsgavkeglldvesvkpvlhvggnkfvvgdhvrhve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.2790000
    Matthews' coefficent 2.43 Rfactor 0.2250000
    Waters 65 Solvent Content 49.40

    Ligand Information
    Ligands SO4 (SULFATE) x 1;FMN (FLAVIN) x 1
    Metals NI (NICKEL) x 2

    Jmol

     
    Google Scholar output for 1eje
    1. Evaluation of protein fold comparison servers
    M Novotny, D Madsen - : Structure, Function, and , 2004 - Wiley Online Library
     
    2. Structural proteomics of an archaeon
    D Christendat, A Yee, A Dharamsi, Y Kluger - nature structural , 2000 - pdg.cnb.uam.es
     
    3. Automated server predictions in CASP7
    JND Battey, J Kopp, L Bordoli, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    4. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    5. 3D-QSAR study for DNA cleavage proteins with a potential anti-tumor ATCUN-like motif
    H Gonzlez-Daz, Snchez-Gonzlez - Journal of inorganic , 2006 - Elsevier
     
    6. Cradle-loop barrels and the concept of metafolds in protein classification by natural descent
    V Alva, KK Koretke, M Coles, AN Lupas - Current opinion in structural , 2008 - Elsevier
     
    7. Characterization of a pseudomonad 2-nitrobenzoate nitroreductase and its catabolic pathway-associated 2-hydroxylaminobenzoate mutase and a chemoreceptor
    H Iwaki, T Muraki, S Ishihara, Y Hasegawa - Journal of , 2007 - Am Soc Microbiol
     
    8. Crystal Structures of the Short-Chain Flavin Reductase HpaC from Sulfolobus tokodaii Strain 7 in Its Three States: NAD (P)+-Free, NAD+-Bound, and NADP+-Bound
    M Okai, N Kudo, WC Lee, M Kamo, K Nagata - Biochemistry, 2006 - ACS Publications
     
    9. Rank information: A structure_independent measure of evolutionary trace quality that improves identification of protein functional sites
    H Yao, I Mihalek, O Lichtarge - Proteins: Structure, Function, , 2006 - Wiley Online Library
     
    10. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    11. ATCUN_like metal_binding motifs in proteins: Identification and characterization by crystal structure and sequence analysis
    R Sankararamakrishnan, S Verma - Structure, Function, and , 2005 - Wiley Online Library
     
    12. Sequence and structure continuity of evolutionary importance improves protein functional site discovery and annotation
    AD Wilkins, R Lua, S Erdin, RM Ward - Protein , 2010 - Wiley Online Library
     
    13. Molecular determinants for FMN-binding in Desulfovibrio gigas flavoredoxin
    M Broco, CM Soares, S Oliveira, SG Mayhew - FEBS letters, 2007 - Elsevier
     
    14. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary

    This protein shares sequence similarity with 375043 which has more annotation.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch