.
The Open Protein Structure Annotation Network
PDB Keyword
.

VR99

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NESG
    Status Expressed
    Target Id VR99
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32171,PF01933 TM1709 Molecular Weight 34630.89 Da.
    Residues 314 Isoelectric Point 5.64
    Sequence mkvvavgggtglstllkglknidsfeitavvsvtdeggssgklrkelnvpppgdvrnnivalakdedlla klmsyrfsegsfkghslgnliiaaltkiegsfseairilervlaikgrvlpvsedharlvarfedgeev igetnivrkggkivevrldrpidalpevleaieradiiifgpgslytsiitnvlvngvkdaikkskakk iyvcnlmtqpgettgyrvsdhvkeleryleqsvdfvlvntrkpseevleryrkegsdfveidaeniqnt ilaepflveivdpsdgqrkirhdsvkladvierisrw
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1709
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch