.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC65287.2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Selected
    Target Id APC65287.2
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26240,NP_459116.1, 3.30.499.10, 99287 TM0111 Molecular Weight 14485.78 Da.
    Residues 129 Isoelectric Point 5.67
    Sequence maktlyeklfdahvvfeapnetpllyidrhlvhevtspqafdglrahhrpvrqpgktfatmdhnvstqtk dinasgemariqmqelikncnefgvelydlnhpyqgivhvmgpeqgvtlpgmtivcgds
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0111
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch