The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4902
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32438,AAD36806, 2336 TM1741 Molecular Weight 27094.92 Da.
    Residues 242 Isoelectric Point 9.16
    Sequence mrvygrkileealrnnvpikkvffqkmknpgsyflslvkevekrgikysfeseerlknlsgtkkhqgvvf digeyryssveeileaktpplivlldqiqdphnlgaivrtsvgagangiiipkdksvkvtetvvkvsag tvfrariavvtnlartieelkekgvwtyasdidgtpiyeedftfptafvfgnegegirrlvrekcdrvv tipmendidslnvsvsvgvvlfeavrqrrmkgag
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Model TM1741
    generated 12/2008
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch