The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4587
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32877,AAD36190, 2336 TM1114 Molecular Weight 25641.30 Da.
    Residues 225 Isoelectric Point 4.43
    Sequence mrkllwlvlmgalftfalaqsalevwkyengqyislpatndlarafsafpadgscnkpewqiefttevqv aqwlewslsatkwtwfvrkpgdyyansvtgtiasngdvivsfsgfddptytgtssvnpeieayytvmtt egmpdqnswvrapdvnnlsytlvdsealhngmlfylwnrikvvncnsastyrntgyiyltlqnqkpwid eegnyvedlenyvtser
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch