.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4490

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4490
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32355,AAD36026, 2336 TM0945 Molecular Weight 49133.33 Da.
    Residues 422 Isoelectric Point 5.30
    Sequence mkrflaillilpvmvlaihpldllvrargnpvyetiiatttqdgdeiyilksygmnwqniqwfhrvgiil psnlnykdrafffitggsrkeeneryydsfledvkenlwvakefeapfivvgdvpnqpifglredalia etfkmflenpdpflpllvpmtygvikamdtaqdflekkgveikgfmvsgaskrgwttyltaifdprvfa iapmvydnlnieaqllhqkeyygtyseklrdyqerglfeilendlgkrlleivdpyamrlrlslpkilv lgtndeywtvdsanlyvddlpgetflfyspndphnlknvkeiietlssffkmypklpkveffyrdgkif veripeivdaelwfarsksrdfrkavwlrrgveetddsligvppekpegfhqayflrvtleinglrmkl cskmmve
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0945
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch