The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Selected
    Target Id APC4348.2
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32409,NP_228517.1, 3.90.1550.10, 243274 TM0708 Molecular Weight 25560.28 Da.
    Residues 227 Isoelectric Point 8.83
    Sequence miekgvfpgalnmaidslmaewsanmnsvlfrfygwkrptvslgrfqkedginvpdwidvvrrpsggral lhhreityclavpkkinfgklsvlefhrlvhslirdalveaglhaelsskrrgntalcfdapsryeivi ngvkvvgsaqfrtaesivehgsivlkqdidllktifgedvpplkgildlydvdvkaleerilaqfekvf gtsrkiqldssmlkearer
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Model TM0708
    generated 12/2008
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch