.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC26398

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Crystallized
    Target Id APC26398
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5354, Molecular Weight 20048.45 Da.
    Residues 178 Isoelectric Point 8.93
    Sequence mshhpdlsvsldqlllrkevrvrqqgewlkrhslplvsftvnmpgavklnaasqtvmdagmraiqelcqktgwrqv acqllvektgpeafvviqapsasmlkkammkierehplgrlmdldvidvdghiisrqgaqlprrrcllcerdavi carsrrhsveallakieemthdyscca
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch