.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC24923

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Crystallized
    Target Id APC24923
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5312, Molecular Weight 18302.60 Da.
    Residues 156 Isoelectric Point 5.42
    Sequence mkridlllnvldstfdkeswyapfkyaiegltaeqamwkpagettntiwenvnhltyykerlaanlegrewthnld gndtfyltkqsnndtewkevversenaqrnlrqvlsaisereleqnslegklldimlhdayhtgqiiqlrkmqga wpskr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch