.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC24461

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC24461
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26422,NP_460575, 99287 TM1616 Molecular Weight 15880.17 Da.
    Residues 145 Isoelectric Point 5.34
    Sequence mindvkwvqaqrhasdwrhaldiavrplitfgaaapcyldgiientlkwgpyyliapgialpharpeqga nhnqisvttlstpvafgnadcdpiwlllcasatdaeahirtiqrisqwldspesvamlqdapndaalfa qltalr
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1616
    generated 12/2008
    Transmembrane protein

    HMM_TM1616

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch