The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Crystallized
    Target Id APC24455
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5296,NP_460534, 99287 TM1575 Molecular Weight 21544.69 Da.
    Residues 192 Isoelectric Point 5.58
    Sequence msylnrderrevilqaamrvalaegfaamtvrriaseadvaagqvhhhfssagelkalafvhlirtllda gqvpppatwrarlhamlgsedggfepyiklwreaqiladrdphirdaylltmqmwheetvtiieqgkqa geftftanatdiawrlialvcgldgmyvlgipemadpafkfhldrmitlelfa
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch