.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC24096

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Diffraction
    Target Id APC24096
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5284, Molecular Weight 12668.03 Da.
    Residues 113 Isoelectric Point 7.90
    Sequence miaktdsdirhvtpsggnvfadlgfhkqdaekfyadslneientlaikqqlmeeitlwitqnqmkqaevatvlhis rprvsdvvnkkcskftidalvnmlsrigkpvrvmvgp
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch