.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC23448

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC23448
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32863,NP_460746, 99287 TM1790 Molecular Weight 15060.29 Da.
    Residues 134 Isoelectric Point 4.69
    Sequence mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiaellrefpqfdw qvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlmrsivdtpaaqetvq
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch