The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC23420
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26172,NP_460583, 99287 TM1624 Molecular Weight 50961.84 Da.
    Residues 447 Isoelectric Point 5.58
    Sequence mantitadeirehfsqamsamyqqevpqygtllelvadvnlavlennpklheqlanadelarlnverhga irvgtaeelstlrrifaimgmypvsyydlsqagvpvhstafrpideaslsrnpfrmftsllrleliena alrqraaeilsqrdiftsrcrqlldeydeqggfsaaqaeefvretletfrwhrqatvdeetyrslhreh rliadvvcfpgchinhltprtldidrvqammpecgitpkiliegpprrevpillrqtsfkaleeqvlfv dekqgthtarfgeieqrgvaltpkgrrlydellhkagtgkdnfthqlhlrevfnafpdsefllrqqgla wfryrltpsgeahrqaihpgddpqpliergwviaqpityedflpvsaagifqsnlgdetlarshgnasr dafeqalgcavrdefslyqeaeerskrrcgll
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Model TM1624
    generated 12/2008
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch