The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Crystallized
    Target Id APC23287
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5263,NP_460014, 99287 TM1039 Molecular Weight 14683.46 Da.
    Residues 132 Isoelectric Point 4.40
    Sequence mflkketftrgdasvalfelsglqrieylefiqkrtakydtdmdgtteadkrvaymqmaleinawlvsrs llngdssqdadtlyqsvqakwsyealdagaesvlmlsglsadkkdnasdsgnesedmtpeks
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Model TM1039
    generated 12/2008
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch