The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC22987
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32755,NP_459559, 99287 TM0567 Molecular Weight 45481.10 Da.
    Residues 391 Isoelectric Point 5.61
    Sequence mnkiikrleiiksaieledeeiirqqliylknepqdavisaiaqaiearrfsdamqeiaawlqaqralst wqdpsiaasklelkaleaqlrdlidkrnarvqilddfndlyhlrlgplmsrilelrkqlavsmqrkqea eikrrekdyqsclqfisqavdqlatlkqqwtglnaasreavgirqriqqqtelitallaeireleadfs hqddsafrqaqenaeqdyhqyreqqqeaqfryardqrlsaderselkrlwrqasrlchpdvvadelkek ahqmmvqlnqarqnadlaairalltqlqsglepmmasdrlnnlehlrhkirqlrtqidallkeitqlet enawrlassvadkeayfseqeralteirntleaqvqqveqellsg
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Model TM0567
    generated 12/2008
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch