.
The Open Protein Structure Annotation Network
PDB Keyword
.

3my7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the ACDH domain of an Alcohol Dehydrogenase from Vibrio parahaemolyticus to 2.25A. To be Published
    Site MCSG
    PDB Id 3my7 Target Id APC91449.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS48693,NP_798500.1, 223926 Molecular Weight 48075.36 Da.
    Residues 452 Isoelectric Point 5.68
    Sequence mpvtnmaeldamiarvkkaqeefatysqeqvdkifraaslaanqariplaqqaveesgmgivedkvikn hfasefiynkykdeqtcgileeddnlgtmtiaepvgiicgivpttnptstaifkslislktrngiifsp hpraknstndaaklvldaavaagapkdiigwidqpsvelsnalmkhddialilatggpgmvkaayssgk paigvgagnvpvvidetadikravasvlmsktfdngvvcaseqavivvdevydevkerfashkahvlsk tdadkvrkvllidgalnakivgqpataiaemagvkvpadtkvligeglgkvsyddafaheklsptlgmf radnfedavaqavtmveiggightsglytnqdvnadriryfgdkmktariliniptthggigdlynfnv apsltlgcgswggnsisenvgpkhlinkktvakraenm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.281
    Matthews' coefficent 2.23 Rfactor 0.229
    Waters 100 Solvent Content 44.90

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 4

    Jmol

     
    Google Scholar output for 3my7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch