The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A Putative C-Terminal Regulatory Domain of Aspartate Kinase from Porphyromonas Gingivalis W83. To be Published
    Site MCSG
    PDB Id 3mah Target Id APC90238.1
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS33294,AAQ67136.1, 242619 Molecular Weight 17371.22 Da.
    Residues 157 Isoelectric Point 5.86
    Sequence sldtekdcikavaakdgitvikvkssnkllswhfmrklfeifefyqepvdmvatsevgvsltidndknl pdivralsdigdvtvdkdmviicivgdmewdnvgfeariinalkgvpvrmisyggsnynvsvlvkaedk kkalialsnklfnsratka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.31 Rfree 0.240
    Matthews' coefficent 1.98 Rfactor 0.211
    Waters 42 Solvent Content 37.84

    Ligand Information
    Ligands SO4 (SULFATE) x 1


    Google Scholar output for 3mah

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch