.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m92

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of yciN, an unchracterized protein from Shigella flexneri. TO BE PUBLISHED
    Site MCSG
    PDB Id 3m92 Target Id APC27530
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS33231,AAP16773, 198215 Molecular Weight 9385.17 Da.
    Residues 83 Isoelectric Point 5.47
    Sequence mnketqpidretllkeankiirehedtlagieatgvtqrngvlvftgdyfldeqglptakstavfnmfk hlahvlsekyhlvd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.241
    Matthews' coefficent 2.47 Rfactor 0.198
    Waters 91 Solvent Content 50.27

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3m92

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch