.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m6y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of 4-Hydroxy-2-Oxoglutarate Aldolase from Bacillus Cereus at 1.45 A Resolution. To be Published
    Site MCSG
    PDB Id 3m6y Target Id APC37980
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS33241,AAP11745.1, PF07071.1.HMM.1, 226900 Molecular Weight 26951.26 Da.
    Residues 251 Isoelectric Point 5.39
    Sequence mtniqkrfykgrvalnvlannienakdifeaaegyvvvgvlskdyptveeavtamkaygkeiddavsig lgagdnrqaavvaeiakhypgshinqvfpsvgatranlgekdswinslvsptgkvgyvnistgpisaag eekaivpiktaialvrdmggnslkyfpmkglaheeeyravakacaeegfaleptggidkenfetivria leanveqviphvyssiidketgntkveavrellavvkklvdqya
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.45 Rfree 0.180
    Matthews' coefficent 1.90 Rfactor 0.152
    Waters 1224 Solvent Content 35.33

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 6;CA (CALCIUM) x 4

    Jmol

     
    Google Scholar output for 3m6y

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch