.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m6j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of unknown function protein from Leptospirillum rubarum. To be Published
    Site MCSG
    PDB Id 3m6j Target Id APC41485.0
    Molecular Characteristics
    Source Leptospirillum sp. group ii uba
    Alias Ids TPS33260,EAY56845, 419542 Molecular Weight 16323.70 Da.
    Residues 143 Isoelectric Point 7.08
    Sequence vsdrpagrmpltvhrnvgrwlseilhasirdtgvssriefvrrtlhgwvreeysetelpnavyrnlyfp vldaqpahagsgkietisecdrlknlvrnvtdtlvenypqgleseallialdgvklelarirkdiemyg dprkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.21658
    Matthews' coefficent 2.08 Rfactor 0.17702
    Waters 518 Solvent Content 40.82

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3m6j

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch