.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m4r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the N-terminal Class II Aldolase domain of a conserved protein from Thermoplasma acidophilum. TO BE PUBLISHED
    Site MCSG
    PDB Id 3m4r Target Id APC64076.1
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS33278,CAC11623.1, 3.40.225.10, 2303 Molecular Weight 24107.20 Da.
    Residues 219 Isoelectric Point 6.38
    Sequence mqnrwaetkfdsdidevvygsrligsdpdlvlhgggntsvktterdhagriisvlrvknsgsnlgtids rgftgirmddalaaakidkmtdeamvdylkksmvnpsepspsvetflhaflpykfvmhshadailsitn tdlpsdqiakilgnvvvlpyippgftlakevmncfkkgidgivlrkhglltfgdtgkeaydrhinivsr aenfirektdgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.233
    Matthews' coefficent 2.53 Rfactor 0.186
    Waters 142 Solvent Content 51.44

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1;ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 3m4r

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch