.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m33

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a functionally unknown protein from Deinococcus radiodurans R1. To be Published
    Site MCSG
    PDB Id 3m33 Target Id APC65760.0
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS33282,AAF10054, 243230 Molecular Weight 24820.90 Da.
    Residues 223 Isoelectric Point 6.72
    Sequence mnhsresydrlarelggyrhpwarvlsgpdpeltfdlwlsrlltpqtrvleagcghgpdaarfgpqaar waaydfspellklaranaphadvyewngkgelpaglgapfglivsrrgptsvilrlpelaapdahflyv gprlnvpevperlaavgwdivaedhvsvlahaptwedwqmrgefmgklarradwdaeatvrgmpyreer hlvlarqlgvarklga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.19 Rfree 0.2144
    Matthews' coefficent 3.92 Rfactor 0.1808
    Waters 98 Solvent Content 68.66

    Ligand Information
    Ligands SO4 (SULFATE) x 10;GOL (GLYCEROL) x 5
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3m33

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch