.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m1r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of formimidoylglutamase from Bacillus subtilis subsp. subtilis str. 168. To be Published
    Site MCSG
    PDB Id 3m1r Target Id APC37635
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS33240,ZP_03593758.1, 224308 Molecular Weight 35061.90 Da.
    Residues 319 Isoelectric Point 5.50
    Sequence mdkypflreagssfkdrdvtkmsdliatwdgqdikgpaligvplskssishsgasfapgtirqalkhss aysaelgehvvsellydlgdidihvtdivkshhhifqtmhallsdhpdwvplilggdnsisystikaia qtkgttaviqfdahhdvrntedggptngtpfrrlldeeiiegqhliqlgirefsnsqayeayakkhnvn ihtmdmirekgliptikeilpvvqdktdfifisvdmdvldqshapgcpaigpgglytdelleavkyiaq qpnvagieivevdptldfrdmtsraaahvllhalkgmklspfk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.20 Rfree 0.2302
    Matthews' coefficent 2.43 Rfactor 0.1764
    Waters 253 Solvent Content 49.36

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 23;CAC (CACODYLATE) x 2
    Metals CL (CHLORIDE) x 9;CA (CALCIUM) x 12

    Jmol

     
    Google Scholar output for 3m1r

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch