.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m1g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a putative glutathione S-transferase from Corynebacterium glutamicum. TO BE PUBLISHED
    Site MCSG
    PDB Id 3m1g Target Id APC61549
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS33264,CAF19967.1, 3.40.30.10, 196627 Molecular Weight 40618.50 Da.
    Residues 359 Isoelectric Point 5.49
    Sequence mantssdwagapqnasadgefvrdtnyiddrivadvpagsepiaqedgtfhwpveagryrlvaaracpw ahrtvitrrllglenvislgltgpthdvrswtfdldpnhldpvlqiprlqdayfnrfpdyprgitvpal veesskkvvtndypsitidfnlewkqfhregapnlypaelreemapvmkriftevnngvyrtgfagsqe ahneaykrlwvaldwledrlstrrylmgdhiteadirlyptlvrfdavyhghfkcgrnkitempnlwgy lrdlfqtpgfgdttdfteikqhyyithaeinptrivpvgpdlsgfatphgreklggspfaegvtlpgpi pageevknpepfqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.10 Rfree 0.176
    Matthews' coefficent 3.21 Rfactor 0.151
    Waters 859 Solvent Content 61.69

    Ligand Information
    Ligands GOL (GLYCEROL) x 12;EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3m1g
    1. Glutathione Transferases of Phanerochaete chrysosporium
    E Meux, P Prosper, A Ngadin, C Didierjean - Journal of Biological , 2011 - ASBMB
     
    2. Structural Understanding of GSH-dependent Reduction Mechanism of Glutathionyl-Hydroquinone Reductases
    AR Green, RP Hayes, L Xun, CH Kang - Journal of Biological Chemistry, 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch