.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m1a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a Short-chain Dehydrogenase from Streptomyces avermitilis to 2A. To be Published
    Site MCSG
    PDB Id 3m1a Target Id APC40476
    Molecular Characteristics
    Source Streptomyces avermitilis ma
    Alias Ids TPS33257,NP_821945.1, 227882 Molecular Weight 29678.42 Da.
    Residues 281 Isoelectric Point 4.71
    Sequence msesakvwlvtgassgfgraiaeaavaagdtvigtarrtealddlvaaypdraeaisldvtdgeridvv aadvlarygrvdvlvnnagrtqvgafeetterelrdlfelhvfgparltrallpqmrergsgsvvniss fggqlsfagfsaysatkaaleqlsegladevapfgikvlivepgafrtnlfgkgaayfseenpayaekv gptrqlvqgsdgsqpgdpakaaaairlaldaektplrlalggdavdfltghldsvraeltewekvsrgt dfdte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.00 Rfree 0.242
    Matthews' coefficent 2.48 Rfactor 0.197
    Waters 980 Solvent Content 50.50

    Ligand Information
    Ligands ACT (ACETATE) x 2
    Metals NA (SODIUM) x 4

    Jmol

     
    Google Scholar output for 3m1a

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch