.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m05

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a functionally unknown protein PEPE_1480 from Pediococcus pentosaceus ATCC 25745. To be Published
    Site MCSG
    PDB Id 3m05 Target Id APC38365
    Molecular Characteristics
    Source Pediococcus pentosaceus atcc 25745
    Alias Ids TPS33249,ABJ68511.1, PF06153.1.HMM.2, 278197 Molecular Weight 12325.50 Da.
    Residues 111 Isoelectric Point 4.75
    Sequence matklviaivqdkdanylsdqfidqnvratklsttggflqsgnttfmigieeervpevleiikkashtr eefmtpsvnmdvnmegttaypikvqvggatvlvlpvdqferf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.15 Rfree 0.2468
    Matthews' coefficent Rfactor 0.1960
    Waters 5 Solvent Content

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 3m05

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch