.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lz8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a Putative Chaperone Dnaj from Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 at 2.9 A Resolution. To be Published
    Site MCSG
    PDB Id 3lz8 Target Id APC63096
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS33275,ABR79864.1, 2.60.260.20, 272620 Molecular Weight 34430.34 Da.
    Residues 305 Isoelectric Point 6.81
    Sequence melkdyyailgvqptddlktiktayrrlarkyhpdvskendaeakfkdlaeawevlkdeqrraeydqlw qhrndpgfgrqrqtheqsysqqdfddifssmfgqqahqrrrqhaarghdleievavfleetlaeqtrti synlpvynvfgmiesetpktlnvkipagvvdgqrirlkgqgtpgenggpngdlwlvihiaphplfdivg hnleivlplapweaalgakvtvptlkesilltvppgsqagqrlrikgkglvskthtgdlfavikivmpt kpdekarelwqqlaaaeasfdprktwgka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.90 Rfree 0.268
    Matthews' coefficent 1.92 Rfactor 0.226
    Waters 7 Solvent Content 35.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lz8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch