.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lyd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative uncharacterized protein from Jonesia denitrificans. To be Published
    Site MCSG
    PDB Id 3lyd Target Id APC37305
    Molecular Characteristics
    Source 471856
    Alias Ids TPS33235,QFG5DDAPXIUU6WRVFOOLG7XFGZM, 471856 Molecular Weight 17606.81 Da.
    Residues 158 Isoelectric Point 5.77
    Sequence mpsirypstefpaltgftvpipetwqpdptmgtqfaarphtppqgftpniigtvrraatgalhnqrtel dqratqlpdyaergrtettvdgfpayhieyayrhhgtitiaqmitlvevshphavdiiqltatcagdqt adywdtfrlmhadltvqphg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.19198
    Matthews' coefficent 2.02 Rfactor 0.16426
    Waters 480 Solvent Content 39.25

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3lyd
    1. The Structure of CyanoP at 2.8 : Implications for the evolution and function of the PsbP subunit of Photosystem II
    F Michoux, K Takasaka, M Boehm, PJ Nixon - Biochemistry, 2010 - ACS Publications
     
    2. Solution structure of CyanoP from Synechocystis sp. PCC 6803: New insights on the structural basis for functional specialization amongst PsbP family proteins
    SA Jackson, MG Hinds, JJ Eaton-Rye - Biochimica et Biophysica Acta (BBA , 2012 - Elsevier
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch