.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lxq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a Protein in the Alkaline Phosphatase Superfamily from Vibrio parahaemolyticus to 1.95A. To be Published
    Site MCSG
    PDB Id 3lxq Target Id APC91208.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS33295,NP_798115.1, 223926 Molecular Weight 50730.52 Da.
    Residues 450 Isoelectric Point 5.35
    Sequence hrplnpamvafsndpllndlalnssysllfavnnmkseksaeqfygkmdnqkmldlvrasstkidfdpt llptmnsnpatyqgkrknlvillqeslgaqfvgslgglpltpnldelmqegwqftqmyatgtrsvrgie avttgfppspsravvklsksqtgfftiadllkeqgyhtqfiyggeanfdnmktfffgngfdqiveekny tnpgfvgswgvsdedlynkadeeferlskgdkpffslvftssnhspyeypegkieqydsehmtrnnavk ysdyalgtffdkakkssywddtifiviadhdarvfganlvpvkhfhipaliigkdiqprkddriannid mpptllsligvdaktpmigrdltkplarederammqydknfgyltrdnlvvlspgekvstmeydfesqt mkplevdesvidrakanalfaskayqnnwysskrtn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.237
    Matthews' coefficent 1.93 Rfactor 0.198
    Waters 268 Solvent Content 36.40

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3lxq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch