.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lvy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Carboxymuconolactone Decarboxylase Family Protein SMU.961 from Streptococcus mutans. To be Published
    Site MCSG
    PDB Id 3lvy Target Id APC41401.0
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS33259,NP_721359, 210007 Molecular Weight 19909.59 Da.
    Residues 183 Isoelectric Point 5.07
    Sequence mskftihtietapervketlrtvkkdnggyipnligllanaptaletyrtvgeinrrnsltpterevvq itaavtngcafcvaghtafsikqiqmapdllealrnatpidddpkldtlakftiavintkgrvgdeafa dflevgytpenaldvvlgvslaslcnyannmadtpinpelqqyvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.236
    Matthews' coefficent 2.39 Rfactor 0.184
    Waters 417 Solvent Content 48.64

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 2;SO4 (SULFATE) x 1
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3lvy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch