.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lvu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ABC transporter, periplasmic substrate-binding protein SPO2066 from Silicibacter pomeroyi. To be Published
    Site MCSG
    PDB Id 3lvu Target Id APC63764.3
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS33277,AAV95337.1, 3.10.105.10, 246200 Molecular Weight 28052.11 Da.
    Residues 255 Isoelectric Point 5.22
    Sequence gmtgfvintrrapfddwrlrealllafnfefindtvtggvmpritsyfsgtdlayrpgtasgreaella pfaadlppgtlegyalpqgdgtarnrtnlrraaqfleqagfrieqgqllgpdgaplalrfllrqgdsdm qtvleiytralerlgiaaqiekvdnaqytarvaeldfdltpfrrdlslspgneqrlywgshsagqpgtr nlmgaaspaidamidrmlaattedeltaatraldrvltagryvipiwr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.79 Rfree 0.20476
    Matthews' coefficent 2.35 Rfactor 0.16905
    Waters 726 Solvent Content 47.61

    Ligand Information
    Ligands GOL (GLYCEROL) x 3;EDO (1,2-ETHANEDIOL) x 5;PG5-PG5 (1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE) x 1
    Metals IOD (IODIDE) x 14

    Jmol

     
    Google Scholar output for 3lvu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch