.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lv9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of CBS domain of a putative transporter from Clostridium difficile 630. To be Published
    Site MCSG
    PDB Id 3lv9 Target Id APC62621.1
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS33272,CAJ69746.1, 3.20.20.70, 272563 Molecular Weight 16927.49 Da.
    Residues 145 Isoelectric Point 4.54
    Sequence glideseqrlvdnifefeekkireimvprtdmvciyesdseekilailkeegvtrypvcrknkddilgf vhirdlynqkinenkieleeilrdiiyisenltidkalerirkeklqlaivvdeyggtsgvvtiedile eivgeiq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.26241
    Matthews' coefficent 2.03 Rfactor 0.20136
    Waters 13 Solvent Content 39.36

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3lv9
    1. Purification, crystallization and preliminary crystallographic analysis of the CBS-domain protein MJ1004 from Methanocaldococcus jannaschii
    I Oyenarte, M Lucas, I Gomez Garcia - Section F: Structural , 2011 - scripts.iucr.org
     
    2. THE STruCTurAL BASiS For iNorGANiC PyroPHoSPHATASE CATALySiS AND rEGuLATioN
    H Tuominen - 2011 - doria.fi
     
    3. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch