.
The Open Protein Structure Annotation Network
PDB Keyword
.

3luq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a PAS Domain from a Sensory Box Histidine Kinase Regulator from Geobacter sulfurreducens to 2.5A. To be Published
    Site MCSG
    PDB Id 3luq Target Id APC87667.1
    Molecular Characteristics
    Source Geobacter sulfurreducens pca
    Alias Ids TPS33284,AAR34789.1, 3.30.450.20, 243231 Molecular Weight 13390.35 Da.
    Residues 114 Isoelectric Point 4.97
    Sequence sderlrlftehapaalamfdremrylavsrrwredyglgdgdilgmshydifpeigeewksvhrrglag evirveedcfvradgrtqwlrwevrpwyegegrvggvviftedit
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.49 Rfree 0.279
    Matthews' coefficent 2.61 Rfactor 0.228
    Waters 18 Solvent Content 52.80

    Ligand Information
    Ligands SO4 (SULFATE) x 3;PGE (TRIETHYLENE) x 5
    Metals

    Jmol

     
    Google Scholar output for 3luq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch