.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lso

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative membrane anchored protein from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 3lso Target Id APC90761.1
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5995,CAE50646.1, 1717 Molecular Weight 51714.96 Da.
    Residues 486 Isoelectric Point 5.01
    Sequence asatetntapsadtqapkpvntvtsdvdcsvsaawglykfnqksnfsaefempesvkagtgfdalikik disvsndnlsgyknakltkssirinvgknvkldgnqpglslsngvlsindhlkaslegnslrisaapit vrlqaltegtltfipektiltntasvdgytanttcttnadkpfatvkvdpadgltitapesasikqdvq itatvpeklnekmdgkvqffvnhiaagdpvpvtednkastsiifdtsgsktitarfidaegynpapdge tiipvvteldtkkpedtdsytglingsatsllkpakvmpgekvsvsasllpnkapirvyeiginapedv kyidgtgktnyssklattgsvfsspgsgyydpewkneskkpnesyrgfhsdtsysvvdtspqtvsaefe ipktlapgiymfqmgvykysnslkdlvsipetafeiagpdlpalperkikpqpeetpevsdgsstaklvksp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.75 Rfree 0.25107
    Matthews' coefficent 2.69 Rfactor 0.21459
    Waters 62 Solvent Content 54.23

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3lso
    1. The extrinsic proteins of Photosystem II
    TM Bricker, JL Roose, RD Fagerlund, LK Frankel - et Biophysica Acta (BBA , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch