.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lsg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586. To be Published
    Site MCSG
    PDB Id 3lsg Target Id APC38995.2
    Molecular Characteristics
    Source Fusobacterium nucleatum subsp. nucleatum atcc 25586
    Alias Ids TPS33252,AAL94395, 190304 Molecular Weight 11968.22 Da.
    Residues 100 Isoelectric Point 6.55
    Sequence keliqniieesytdsqftlsvlsekldlssgylsimfkknfgipfqdyllqkrmekakllllttelkny eiaeqvgfedvnyfitkfkkyyqitpkqyre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.2404
    Matthews' coefficent 2.33 Rfactor 0.1846
    Waters 263 Solvent Content 47.31

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3lsg
    1. Computer-Based Annotation of Putative AraC/XylS-Family Transcription Factors of Known Structure but Unknown Function
    A Schller, AW Slater, T Norambuena - Journal of Biomedicine , 2012 - hindawi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch