.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lqk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dipicolinate synthase subunit B from Bacillus halodurans C. To be Published
    Site MCSG
    PDB Id 3lqk Target Id APC41279.0
    Molecular Characteristics
    Source Bacillus halodurans c
    Alias Ids TPS33258,BAB06121, 272558 Molecular Weight 21563.88 Da.
    Residues 197 Isoelectric Point 6.91
    Sequence mnfagkhvgfgltgshctyhevlpqmerlvelgakvtpfvthtvqttdtkfgessewinkikqiteepi vdsmvkaepfgpktpldcmviapmtgnstskfanamtdspvlmgakatlrngkpvvvgistndalglng inimrlmatkniyfipfgqdnpqvkpnslvarmealpetieaalrgqqyqpvliekfrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.21296
    Matthews' coefficent 2.79 Rfactor 0.16658
    Waters 84 Solvent Content 55.93

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3lqk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch