.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lor

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a Thiol-disulfide Isomerase from Corynebacterium glutamicum to 2.2A. To be Published
    Site MCSG
    PDB Id 3lor Target Id APC61551
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS33270,CAF19620.1, 3.40.30.10, 196627 Molecular Weight 17973.80 Da.
    Residues 160 Isoelectric Point 5.05
    Sequence mssldnaplleldvqewvnheglsnedlrgkvvvvevfqmlcpgcvnhgvpqaqkihrmidesqvqvig lhsvfehhdvmtpealkvfidefgikfpvavdmpregqripstmkkyrlegtpsiiladrkgrirqvqf gqvddfvlglllgsllsetdet
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.259
    Matthews' coefficent 2.66 Rfactor 0.212
    Waters 96 Solvent Content 53.90

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals CL (CHLORIDE) x 5;CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 3lor

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch