.
The Open Protein Structure Annotation Network
PDB Keyword
.

3loq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a universal stress protein from Archaeoglobus fulgidus DSM 4304. To be Published
    Site MCSG
    PDB Id 3loq Target Id APC60070
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS33261,AAB89491.1, 3.40.50.620, 224325 Molecular Weight 29552.48 Da.
    Residues 270 Isoelectric Point 5.29
    Sequence mllptdlsensfkvleylgdfkkvgveeigvlfvinltklstvsggididhyidemsekaeevlpevaq kieaagikaevikpfpagdpvveiikasenysfiamgsrgaskfkkillgsvsegvlhdskvpvyifkh dmvvnslfdrvlvaydfskwadraleyakfvvkktggelhiihvsedgdktadlrvmeevigaegievh vhiesgtphkailakreeinattifmgsrgagsvmtmilgstsesvirrspvpvfvckrgdde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.32 Rfree 0.2248
    Matthews' coefficent 3.39 Rfactor 0.1786
    Waters 75 Solvent Content 63.71

    Ligand Information
    Ligands AMP (ADENOSINE) x 3;ACT (ACETATE) x 4
    Metals CL (CHLORIDE) x 8

    Jmol

     
    Google Scholar output for 3loq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch