.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lof

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of C-terminal domain of human heat shock 70kDa protein 1B. To be Published
    Site MCSG
    PDB Id 3lof Target Id APC67086.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS33283,NP_005337, 9606 Molecular Weight 11467.17 Da.
    Residues 108 Isoelectric Point 4.95
    Sequence ervsaknalesyafnmksavedeglkgkiseadkkkvldkcqeviswldantlaekdefehkrkeleqv cnpiisglyqgaggpgpggfgaqgpkggsgsgptieevd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.235
    Matthews' coefficent 2.54 Rfactor 0.192
    Waters 134 Solvent Content 51.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lof
    1. The C-terminal Helices of Heat Shock Protein 70 Are Essential for J-domain Binding and ATPase Activation
    XC Gao, CJ Zhou, ZR Zhou, M Wu, CY Cao - Journal of Biological , 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch