.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lod

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the putative acyl-CoA N-acyltransferase from Klebsiella pneumoniae. To be Published
    Site MCSG
    PDB Id 3lod Target Id APC60650
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS33262,ABR77064.1, 3.40.630.30, 272620 Molecular Weight 17646.17 Da.
    Residues 160 Isoelectric Point 5.29
    Sequence mytitdiaptdaefialiaaldawqetlypaesnhlldlsqlppqtvialairspqgeavgcgaivlse egfgemkrvyidpqhrgqqlgekllaaleakarqrdchtlrletgihqhaaialytrngyqtrcafapy qpdplsvfmekplfadlrsaal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.26308
    Matthews' coefficent 3.04 Rfactor 0.22569
    Waters 23 Solvent Content 59.48

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lod

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch