.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lnp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Amidohydrolase family Protein OLEI01672_1_465 from Oleispira antarctica. To be Published
    Site MCSG
    PDB Id 3lnp Target Id APC40080
    Molecular Characteristics
    Source Oleispira antarctica
    Alias Ids TPS33254,OLEI01672_1_465, 188908 Molecular Weight 50668.66 Da.
    Residues 465 Isoelectric Point 5.00
    Sequence mskdsesnlaqrqsqpkahadlrinshwiipienttdhnlvsnilidhcllikdgiilaiepqsscqip atetldlgqqvlmpgwvnahghaamslfrgladdlplmtwlqehvwpaeaqhvdehfvkqgtelaiaem iqsgtttfadmyfypqqsgeaalaagiravcfapvldfptnyaqnadeyirkaiecndrfnnhpmneqg lvqigfgphapytvsdeplkeitmlsdqldmpvqihlhetdfevsesletfnkrptqrladigflnerv scvhmtqvddgdikilqktgasiihcpesnlklasgfcpiaklsaaniplaigtdgaasnndldmfset ktaallakgvsqdasaipaiealtmatlggaralgidditgslkpgkaadiqaidlntlssqpvfdpvs hmvyctkstqvshvwvngrcllkngelttlneetlinhakawasairtpik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.184
    Matthews' coefficent 2.44 Rfactor 0.149
    Waters 312 Solvent Content 49.59

    Ligand Information
    Ligands ACY (ACETIC) x 2;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 3lnp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch