.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lmb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein OLEI01261 with unknown function from Chlorobaculum tepidum TLS. To be Published
    Site MCSG
    PDB Id 3lmb Target Id APC40303
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS33256,OLEI01261, 194439 Molecular Weight 18517.18 Da.
    Residues 165 Isoelectric Point 5.21
    Sequence mnasltpdqvskklkqffsdhlpisqfmgleiesydgdtliltaplepnindkqtafggslynaavmac wgmvylktqeeniacnqvvtegnmkyiapvygriraichapdeeelanffdhferkgkarisleaaiyn dacvmkiepetkpsvkfngqyailknq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.22193
    Matthews' coefficent 2.25 Rfactor 0.16644
    Waters 134 Solvent Content 45.22

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lmb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch